Gene ipotf_pan_p003402
| Sequence ID | ipotf_pan_p003402 add to my list | ||
|---|---|---|---|
| Species | Ipomoea trifida | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 176aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 176 amino acids
>ipotf_pan_p003402_IPOTF MEPVAHAGCILKVDVQCDSCKLNVLEVLSSINGVYSVSIDAEEGVARVSGEVDPNRLLTA LARSGRHAEVKTVNLRHPLLNRGYGASSYGNGYGYGAIDDPYMYAGRRGLPEYSMCGGGG GGYEAQHHGNVNYPIRGYGGHAAAAAANPFYDVSSYQRYAAQAMASPFRYGHYNYY
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP241299 | Unannotated cluster |
| 3 | GP344409 | Unannotated cluster |
| 4 | GP543162 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ipotf_pan_p003402
Represented sequence(s):
IPOTF_NSP306
IPOTF_Y22
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Oeu049387.1 | orthology | 1 | 2 | 109 | 4.08e-31 |
| PGSC0003DMP400038366 | orthology | 1 | 4 | 101 | 1.33e-27 |
| Solyc07g065430.2.1 | orthology | 1 | 4 | - | - |
| capan_pan_p030197 | orthology | 1 | 3 | - | - |