Gene ipotf_pan_p019321
Sequence ID | ipotf_pan_p019321 add to my list | ||
---|---|---|---|
Species | Ipomoea trifida | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 236aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 236 amino acids
>ipotf_pan_p019321_IPOTF MKSRRELFCASHASTAICSSMDQRRIVRPRSRPPAPPCSSHLPFHPTSFRKTPKDPSPAT SNSPGRSSRHLLTDSTFLDQILSDSNNIQALVPYQPFETTKVQHTSGDNLAVIPSLPPPP SPPKLPRVVCNPSSLILDSNVKTSSSSTPTHRNHQVVELRVAIHCKGCEGKVRKHLSKME GVTSFSIDLDSKKVTVIGNVTPLGVLANISKVKNAQFWPSPVTSSPSSPRVTLPIR
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ipotf_pan_p019321
Represented sequence(s):
IPOTF_Y22
IPOTF_NSP306
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_4_477.7 | orthology | 0.78 | 2 | - | - |
Ca_84_91.1 | orthology | 0.77 | 3 | - | - |
Cc01_g12180 | orthology | 0.768 | 3 | - | - |
Oeu040283.1 | orthology | 0.823 | 4 | - | - |
Oeu058521.1 | orthology | 0.757 | 4 | - | - |
PGSC0003DMP400027269 | orthology | 0.82 | 6 | - | - |
Solyc11g073020.1.1 | orthology | 0.816 | 6 | - | - |
capan_pan_p010270 | orthology | 0.774 | 5 | - | - |
itb07g12040.t1 | orthology | 0.0249 | 1 | 444 | 4.7e-161 |