Gene ipotf_pan_p020842
Sequence ID | ipotf_pan_p020842 add to my list | ||
---|---|---|---|
Species | Ipomoea trifida | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 147aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 147 amino acids
>ipotf_pan_p020842_IPOTF MRVHMDCGGCESKIRKALQKLKGVDEVDIDMAMQKVTVTGWADQKKVLKTVRKTGRRAEI WQFPFNNPEMVNHNNHVAGYYPQQSYGGPATFHCTSQPPSSSYNYYKHGYDNFDRSFRLG RGNSGNIFGSRIGGTFSDENPHSCSIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ipotf_pan_p020842
Represented sequence(s):
1. | 2. | 3. | 4. | |
---|---|---|---|---|
1. itf00g39270.t1 | 0.00 | 1.37 | 1.32 | 1.32 |
2. itf02g13170.t1 | 1.37 | 0.00 | -0.00 | -0.00 |
3. Itr.Sc0000033.85 | 1.32 | -0.00 | 0.00 | -0.00 |
4. Itr.Sc0000033.84 | 1.32 | -0.00 | -0.00 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cc05_g08310 | orthology | 0.556 | 4 | 176 | 6.97e-58 |
Oeu042935.1 | orthology | 0.464 | 3 | 196 | 1.13e-65 |
PGSC0003DMP400035470 | orthology | 0.387 | 4 | 154 | 1.64e-49 |
Solyc07g055010.2.1 | orthology | 0.399 | 4 | 204 | 1.2e-68 |
capan_pan_p019104 | orthology | 0.391 | 3 | 209 | 1.26e-70 |
itb02g08570.t1 | orthology | 0.0069 | 1 | 310 | 8.13e-111 |