Gene ipotf_pan_p024342
Sequence ID | ipotf_pan_p024342 add to my list | ||
---|---|---|---|
Species | Ipomoea trifida | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 174aa | ||
Gene Ontology |
![]()
|
Length: 174 amino acids
>ipotf_pan_p024342_IPOTF MTTFVLKVGIHCNGCARDVKKNVEKMEGVESVKVNSEQQTAVITGTVHPDKVIAKLYKKF KKRAELLPNKPAIKQGTVTKVSSHCTSLSMTTFVLKVGIHCNGCARDVKKNVEKMEGVES VKVNSEQQTAVITGTVHPDKVIAKLYKKFKKRAELLPNKPAIKQGTGRRVTFAL
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ipotf_pan_p024342
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
MELO3C020302.2.1 | orthology | 1 | 3 | - | - |
cucsa_pan_p016069 | orthology | 1 | 3 | - | - |
cucsa_pan_p021160 | orthology | 1 | 3 | - | - |
medtr_pan_p024217 | orthology | 1 | 3 | - | - |
soybn_pan_p037062 | orthology | 1 | 3 | - | - |
soybn_pan_p040391 | orthology | 1 | 3 | - | - |
vitvi_pan_p017756 | orthology | 1 | 2 | - | - |
vitvi_pan_p040146 | orthology | 1 | 2 | - | - |