Gene ipotf_pan_p028840
| Sequence ID | ipotf_pan_p028840 add to my list |
|---|---|
| Species | Ipomoea trifida |
| Alias | No gene alias |
| Pangenome status | Dispensable (1/2) |
| Length | 71aa |
Length: 71 amino acids
>ipotf_pan_p028840_IPOTF MGKKMNQLESDKVLSNLEWHFKLGTTPKTVSEKEWWEETDKKFQAWPRTAGPPVVMNPIS RQNFIVKSADN
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for ipotf_pan_p028840