Gene ipotf_pan_p029827
| Sequence ID | ipotf_pan_p029827 add to my list |
|---|---|
| Species | Ipomoea trifida |
| Alias | No gene alias |
| Pangenome status | Dispensable (1/2) |
| Length | 110aa |
Length: 110 amino acids
>ipotf_pan_p029827_IPOTF MSNQLVITTCFRRQFGGATLMVQRLGLHHVSIKYQLNPFECCVFVDEKQKELEKHLIEQK HSRVSVCGRFVPQDVAIQIRKRTNRRVEILDVQEFNEIPEHKQPPLFITS
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.