Gene ipotf_pan_p031383


Sequence ID ipotf_pan_p031383  add to my list
Species Ipomoea trifida
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 102aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 102 amino acids

>ipotf_pan_p031383_IPOTF
MEPYADVSCILRVDTNCDACKFKMIEVISSVAGVYSISIDAEENLVKICGEVDPNRLLSA
LAREGNALFVSKRAVGDQDSSRGKVESGNLNEDQKLVRIRTT




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP241299 Unannotated cluster
3 GP344409 Unannotated cluster
4 GP469723 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for ipotf_pan_p031383



Represented sequence(s):
IPOTF_Y22
Itr.xfSc0000087.5
Unrepresented genome(s):
IPOTF_NSP306


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Solyc09g064730.2.1 orthology 1 3 - -
capan_pan_p015895 orthology 1 3 - -
medtr_pan_p032119 orthology 1 2 - -