Gene itb01g10210.t2
| Sequence ID | itb01g10210.t2 add to my list | ||
|---|---|---|---|
| Species | Ipomoea triloba | ||
| Alias | No gene alias | ||
| Length | 271aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 271 amino acids
>itb01g10210.t2_IPOTR MGEEKKGEGKEGEKKEEVSKEEKKEEKKEEEENIEIVLKVDMHCEACARKVTRSLKGFQG VEEVTADYKASKVVVKGNKSVDPMKVCERIQKKSGRKVDLISPIPKPPAAEETKQEIKEP PKEEKKDEPPPVATVVLKVQMHCEACAQVLQKRIKKIKGVESVTTELGSNEVRVKGVVDP EKLARDVYKKTGKQASIVKEEEKKEEQEKKEGEKKEGEKKEGEEGKGEEDEKKMETEMKK NEFMPPKYYLDYAYPPPQIFSDENPHACTLM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb01g10210.t2
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_14_162.1 | orthology | 0.464 | 4 | 202.6 | 8.5e-52 |
| Ca_32_762.1 | orthology | 0.528 | 4 | - | - |
| Ca_69_1.19 | orthology | 0.528 | 4 | - | - |
| Ca_78_26.1 | orthology | 0.464 | 4 | - | - |
| Ca_9_645.2 | orthology | 0.523 | 3 | - | - |
| Cc09_g00430 | orthology | 0.523 | 4 | 156.4 | 2.4e-38 |
| Cg2g046420.1 | orthology | 0.595 | 10 | 190.7 | 1.2e-48 |
| Cm145580.1 | orthology | 0.811 | 9 | - | - |
| Cm298860.1 | orthology | 0.6 | 9 | - | - |
| Cs2g01750.1 | orthology | 0.595 | 10 | 201.1 | 9.5e-52 |
| DCAR_002239 | orthology | 0.471 | 6 | 196.8 | 1.9e-50 |
| DCAR_030843 | orthology | 0.513 | 6 | - | - |
| FvH4_3g00420.1 | orthology | 0.559 | 10 | 189.9 | 2.1e-48 |
| HanXRQChr16g0515801 | orthology | 0.614 | 6 | 180.3 | 2.7e-45 |
| MELO3C008010.2.1 | orthology | 0.702 | 9 | 187.6 | 9e-48 |
| Manes.09G082500.1 | orthology | 0.748 | 9 | 202 | 2.9e-64 |
| Manes.S022000.1 | orthology | 0.522 | 9 | 163.7 | 1.8e-40 |
| Oeu029318.1 | orthology | 0.396 | 5 | 251 | 3.19e-84 |
| Oeu057024.1 | orthology | 0.434 | 5 | 208.4 | 8.9e-54 |
| PGSC0003DMP400023518 | orthology | 0.505 | 4 | - | - |
| Solyc11g012690.1.1 | orthology | 0.554 | 4 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.57 | 8 | 220 | 5.18e-72 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.507 | 8 | 184.9 | 7.7e-47 |
| capan_pan_p018045 | orthology | 0.52 | 3 | - | - |
| cicar_pan_p024449 | orthology | 0.527 | 7 | 229 | 6.34e-75 |
| cucsa_pan_p011686 | orthology | 0.69 | 9 | 203 | 1.29e-64 |
| ipotf_pan_p000797 | orthology | 0.0072 | 1 | 384 | 5.79e-136 |
| maldo_pan_p012376 | orthology | 0.571 | 10 | - | - |
| maldo_pan_p020510 | orthology | 0.581 | 10 | 250 | 5.13e-83 |
| medtr_pan_p010658 | orthology | 0.513 | 7 | 230 | 3.12e-75 |
| phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.521 | 8 | 205.3 | 5e-53 |
| phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.558 | 8 | - | - |
| soybn_pan_p008938 | orthology | 0.501 | 7 | - | - |
| soybn_pan_p009673 | orthology | 0.534 | 7 | - | - |
| soybn_pan_p024238 | orthology | 0.515 | 7 | 240 | 2.89e-79 |
| thecc_pan_p018912 | orthology | 0.49 | 9 | 223 | 3.04e-72 |
| vitvi_pan_p012828 | orthology | 0.549 | 8 | 237 | 3.61e-78 |