Gene itb06g23970.t1


Sequence ID itb06g23970.t1  add to my list
Species Ipomoea triloba
Alias No gene alias
Length 151aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 151 amino acids

>itb06g23970.t1_IPOTR
MGVAGTLEFLSDLLSSAKRSKKKKKQVNTVAIKIRMDCEGCVRKVKKVLSGVKGAKSVDV
DLKQQKATVTGFVDAKKVMKAAKSTGKKCEPWPYVPYAMVAHPYVAGVYDKKAPPNFVRA
TNDPAIANLNPMEEQFTLMFSDENPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for itb06g23970.t1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_51_149.3 orthology 0.309 5 238.8 6e-63
Ca_54_61.7 orthology 0.322 4 - -
Cc00_g30010 orthology 0.309 5 238.8 2e-63
Oeu024561.1 orthology 0.25 3 - -
Oeu061475.1 orthology 0.282 3 250 1.5e-66
PGSC0003DMP400016735 orthology 0.24 4 - -
PGSC0003DMP400016737 orthology 0.233 4 247.7 5.1e-66
Solyc04g072700.2.1 orthology 0.232 4 250.8 6e-67
capan_pan_p000483 orthology 0.202 3 251 3.93e-87
ipotf_pan_p013731 orthology 0.0071 1 296 2.76e-105