Gene itb07g12040.t1
| Sequence ID | itb07g12040.t1 add to my list | ||
|---|---|---|---|
| Species | Ipomoea triloba | ||
| Alias | No gene alias | ||
| Length | 233aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 233 amino acids
>itb07g12040.t1_IPOTR MKSRRELFCASHASTAICSSMDQRRIVRPRSRPPAPPCSSHLPFHPTSFRKTPKDPSPAT SNSPGRSSRHLLTDSTFLDQILSDSNNIQALVPYHPFETAKVQHTSGDNLAVIPSLPPPP KLPPVLCNPSSLTLDSNVKTSSSSTPTHRNHQVVELRVAIHCKGCEGKVRKHLSKMEGVT SFSIDLDSKKVTVIGNVTPLGVLANISKVKNAQFWPSPATSSPSSPRVNLPIR
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb07g12040.t1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_4_477.7 | orthology | 0.764 | 2 | - | - |
| Ca_84_91.1 | orthology | 0.754 | 3 | - | - |
| Cc01_g12180 | orthology | 0.753 | 3 | - | - |
| Oeu040283.1 | orthology | 0.807 | 4 | - | - |
| Oeu058521.1 | orthology | 0.742 | 4 | - | - |
| PGSC0003DMP400027269 | orthology | 0.804 | 6 | - | - |
| Solyc11g073020.1.1 | orthology | 0.8 | 6 | - | - |
| capan_pan_p010270 | orthology | 0.759 | 5 | - | - |
| ipotf_pan_p019321 | orthology | 0.0249 | 1 | 446 | 1.55e-161 |