Gene itb09g19040.t1
| Sequence ID | itb09g19040.t1 add to my list | ||
|---|---|---|---|
| Species | Ipomoea triloba | ||
| Alias | No gene alias | ||
| Length | 198aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 198 amino acids
>itb09g19040.t1_IPOTR MGKEEKEEVKGEKKTEVITAVYRVRLHCPQCAHDIRKPLLRTPGVHTVDVKFEKDEVEVT GGIDAKIIHQRLEKWRIHNVKTDFKSQTITVETVAESEKIASYVRKALGKHVEIVTAKKE EEKKEKIIVKEKKEEVMVEEKKEKVVVETKSGEKFEEFKEVNKVEVKVKEGGGAPYFIHY VYAPQWFSDENPNACLIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP342504 | Unannotated cluster |
| 4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb09g19040.t1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_46_563.1 | orthology | 0.493 | 4 | - | - |
| Ca_64_447.2 | orthology | 0.489 | 5 | 120.9 | 2.4e-27 |
| Cc02_g26130 | orthology | 0.489 | 5 | 146.4 | 1.8e-35 |
| DCAR_029550 | orthology | 0.643 | 4 | 164.5 | 7.8e-41 |
| HanXRQChr06g0168381 | orthology | 0.722 | 5 | 79.7 | 3.6e-15 |
| Oeu036922.1 | orthology | 0.472 | 4 | 55.5 | 7.1e-08 |
| PGSC0003DMP400011529 | orthology | 0.398 | 4 | 167.5 | 8.8e-42 |
| Solyc10g039390.1.1 | orthology | 0.452 | 4 | 166.8 | 1.5e-41 |
| capan_pan_p023451 | orthology | 0.425 | 3 | 124 | 1.35e-36 |
| ipotf_pan_p011107 | orthology | 0.0241 | 1 | 269 | 2.8e-92 |