Gene itb10g02670.t1
| Sequence ID | itb10g02670.t1 add to my list | ||
|---|---|---|---|
| Species | Ipomoea triloba | ||
| Alias | No gene alias | ||
| Length | 136aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 136 amino acids
>itb10g02670.t1_IPOTR MRVHMDCPGCESKIKKALKKLDGVDEVDIEMEKQKVTVTGWADQMKVVKTVRKTGRKAEL WPYPYNPEYHSFAHRYYNFYCNPSTHFSKPYSYNYHKHGYNGHDHGYYQEAPYSTIIDEQ TSKMFSDENATGCSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb10g02670.t1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_23_1086.1 | orthology | 0.415 | 4 | - | - |
| Ca_24_186.3 | orthology | 0.427 | 5 | 143.7 | 2.4e-34 |
| Ca_42_221.2 | orthology | 0.427 | 6 | - | - |
| Ca_66_295.2 | orthology | 0.427 | 6 | - | - |
| Cc02_g14880 | orthology | 0.405 | 5 | 154.1 | 5.9e-38 |
| Oeu043106.1 | orthology | 0.446 | 3 | 141 | 8.8e-34 |
| PGSC0003DMP400018109 | orthology | 0.441 | 6 | 107.5 | 7.4e-24 |
| Solyc02g076880.2.1 | orthology | 0.463 | 6 | 156 | 1.8e-38 |
| capan_pan_p000797 | orthology | 0.449 | 5 | 184 | 2.33e-61 |
| ipotf_pan_p011098 | orthology | 0.0274 | 1 | 183 | 2.34e-61 |