Gene itb11g17540.t1
| Sequence ID | itb11g17540.t1 add to my list | ||
|---|---|---|---|
| Species | Ipomoea triloba | ||
| Alias | No gene alias | ||
| Length | 93aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 93 amino acids
>itb11g17540.t1_IPOTR MALISWAKKEFARLKLQNPKRISLPPPPSLSPVVSISAAASQPAKDVELAVDLRCANCQK RIATAISNIDDLESIEVDVLVKTVKITRKSRST
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP509151 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb11g17540.t1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cc04_g07230 | orthology | 1 | 2 | 68.2 | 2.9e-12 |
| ipotf_pan_p020688 | orthology | 0.0211 | 1 | 171 | 1.42e-57 |