Gene itb11g17740.t1
| Sequence ID | itb11g17740.t1 add to my list |
|---|---|
| Species | Ipomoea triloba |
| Alias | No gene alias |
| Length | 255aa |
Length: 255 amino acids
>itb11g17740.t1_IPOTR MAKAAENQDVGMGDPEEQSSESEFETESEEEEEDQEQVVKLAEPSRNAVYNKDGLLDKLG DISWPDKAGWMHKLSIDIDQEGEVDVNDDLPRELSFYTQALQGTREAYLKFQSDGVPFLR PSDYYAEMVKSDVHMEKVKGRLLAEKKKIEEAEERKKARENKKLAKEQNGFDKDSNAELD LDLEDGKVFQRPNKKRPGVSPGDRSGGKGRPHGGNNKKGSDKKPKGRENRNSKFGFGGKK GLKKQNTADSTNDFR
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP075980 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Eukaryotic rRNA processing
IPR008610
|
Eukaryotic rRNA processing | Family |
Figure 1: IPR domains for itb11g17740.t1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G22660.1 | orthology | 0.583 | 3 | - | - |
| PGSC0003DMP400055292 | orthology | 0.457 | 3 | - | - |
| PGSC0003DMP400055391 | orthology | 0.441 | 3 | - | - |
| Solyc01g006090.2.1 | orthology | 0.455 | 3 | - | - |
| Solyc01g006170.2.1 | orthology | 0.44 | 2 | - | - |
| brana_pan_p006433 | orthology | 0.565 | 4 | - | - |
| brana_pan_p007884 | orthology | 0.564 | 5 | - | - |
| brana_pan_p012403 | orthology | 0.558 | 4 | - | - |
| brana_pan_p034179 | orthology | 0.546 | 4 | - | - |
| braol_pan_p022657 | orthology | 0.544 | 4 | - | - |
| braol_pan_p024061 | orthology | 0.605 | 5 | - | - |
| braol_pan_p030426 | orthology | 0.565 | 4 | - | - |
| brarr_pan_p009571 | orthology | 0.547 | 4 | - | - |
| brarr_pan_p026538 | orthology | 0.553 | 3 | - | - |
| brarr_pan_p031703 | orthology | 0.552 | 4 | - | - |
| capan_pan_p017109 | orthology | 0.537 | 2 | - | - |