Gene itb12g27060.t1


Sequence ID itb12g27060.t1  add to my list
Species Ipomoea triloba
Alias No gene alias
Length 141aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 141 amino acids

>itb12g27060.t1_IPOTR
MANLQIVPAGTIANNVEAQFVEMMVPLYSHGCERKIKKALSHLKGIYSVNVDFNQQKVTV
WGICNKSDVLSTVRSKRKDARFWNPKDNATAAVEGGGRTEEQSQTPPNQRRLSAPPLALL
RVRSLSWKLTLKKAFTRTYSF




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP342521 Unannotated cluster
4 GP077751 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for itb12g27060.t1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Oeu017371.1 orthology 0.476 3 156 2.7e-38
PGSC0003DMP400001118 orthology 0.404 4 183.7 8.4e-47
Solyc03g080110.2.1 orthology 0.433 4 142.5 2.1e-34
capan_pan_p026120 orthology 0.347 3 188 8.23e-63
ipotf_pan_p002351 orthology 0.0132 1 254 7.77e-89