Gene itb14g01920.t1
Sequence ID | itb14g01920.t1 add to my list | ||
---|---|---|---|
Species | Ipomoea triloba | ||
Alias | No gene alias | ||
Length | 84aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 84 amino acids
>itb14g01920.t1_IPOTR MSGQVCCMELRINLDCAACCRKMKRVLLRMKEIEQHMIERQSCRVSVCGRFDPGDVAIKI RKKMNRRVEILDVQIFTNRDGQPE
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP109350 | Unannotated cluster |
3 | GP119142 | Unannotated cluster |
4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb14g01920.t1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
PGSC0003DMP400019266 | orthology | 0.9 | 4 | - | - |
Solyc05g016190.2.1 | orthology | 0.947 | 4 | - | - |
capan_pan_p026342 | orthology | 0.876 | 3 | - | - |
ipotf_pan_p028439 | orthology | 0 | 1 | 174 | 6.34e-59 |