Gene itb15g00310.t1
| Sequence ID | itb15g00310.t1 add to my list | ||
|---|---|---|---|
| Species | Ipomoea triloba | ||
| Alias | No gene alias | ||
| Length | 323aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 323 amino acids
>itb15g00310.t1_IPOTR MGQKEEAKKEGGEKKGGDAAVKKEEKPTAVVLKADLHCEGCAKKVRRSIRHFDGVEDVKT DWESGKLTVKGNVDPAWLRDILASKIKKKVEILSPQPKKDGGGGGGAAGDKKSDDKSAKK DEKDTEKKPKEPQVSTVVLTVRLHCDGCADKVKRIIRKINGVKDVDVDLAKDLVTVKGSM DVKEITAYLREKLKRGVEVVPSKKDGGEGEKKKMVDDGEKKEKKEKGGGSESSKVEANKM EYHGFQSNTFYARPIYNQSYYNQDYGLTMSDPSSSHAAMGYSYPYAHAPPPYMHVPPTPP PTYVHAPSPNMFSDEDPNACSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP071484 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb15g00310.t1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_452_22.1 | orthology | 0.666 | 5 | - | - |
| Ca_52_14.1 | orthology | 0.661 | 4 | - | - |
| Ca_7_292.1 | orthology | 0.666 | 5 | - | - |
| Cc06_g04230 | orthology | 0.654 | 5 | - | - |
| DCAR_014996 | orthology | 0.725 | 5 | - | - |
| DCAR_017683 | orthology | 0.71 | 5 | - | - |
| HanXRQChr01g0027741 | orthology | 0.853 | 5 | - | - |
| HanXRQChr13g0401031 | orthology | 0.916 | 5 | - | - |
| HanXRQChr14g0454431 | orthology | 0.792 | 5 | - | - |
| HanXRQChr17g0570331 | orthology | 0.779 | 5 | - | - |
| Oeu005022.1 | orthology | 0.721 | 4 | - | - |
| Oeu016984.1 | orthology | 0.694 | 4 | - | - |
| Oeu019283.1 | orthology | 0.655 | 4 | - | - |
| Oeu045227.1 | orthology | 0.786 | 4 | - | - |
| Oeu061953.1 | orthology | 0.72 | 4 | - | - |
| PGSC0003DMP400006915 | orthology | 0.488 | 4 | - | - |
| Solyc09g008200.2.1 | orthology | 0.528 | 4 | - | - |
| Solyc10g086280.1.1 | orthology | 0.669 | 3 | - | - |
| capan_pan_p000093 | orthology | 0.795 | 3 | - | - |
| capan_pan_p021581 | orthology | 0.549 | 3 | - | - |
| ipotf_pan_p002813 | orthology | 0.0426 | 1 | 422 | 2.63e-149 |