Gene maize_pan_p021681
Sequence ID | maize_pan_p021681 add to my list | ||
---|---|---|---|
Species | Zea mays | ||
Alias | No gene alias | ||
Pangenome status | Core (4/4) | ||
Length | 157aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 157 amino acids
>maize_pan_p021681_MAIZE MTLIQPSAFSGSEPRKRRRIIILMAARGFQLRLSRWFQRSHASVSQSQDEDDRGGERNGL LRSHLDQIVPVTDFAGTSNSKALAVRVEPKTVALKVSMHCYGCARKVEKQVKKLQGVVSI RVELESKRLTVVGDVSPTDVLECVCKVTKHAEILQAP
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maize_pan_p021681
Represented sequence(s):
MAIZE_CML247_v1.0
MAIZE_Mo17_v1.0
MAIZE_PH207_v1.0
MAIZE_B73_v4.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Dr20434 | orthology | 1 | 3 | - | - |
Mba01_g17650.1 | orthology | 1 | 5 | - | - |
Mba08_g26390.1 | orthology | 1 | 5 | - | - |
XP_008776942.1 | orthology | 1 | 4 | - | - |
XP_008809019.1 | orthology | 1 | 5 | - | - |
XP_010925099.1 | orthology | 1 | 6 | - | - |
XP_010939249.1 | orthology | 1 | 5 | - | - |
cocnu_pan_p000998 | orthology | 1 | 5 | - | - |
cocnu_pan_p007495 | orthology | 1 | 6 | - | - |
musac_pan_p002002 | orthology | 1 | 5 | - | - |
musac_pan_p039784 | orthology | 1 | 5 | - | - |
sorbi_pan_p016251 | orthology | 0.177 | 1 | 201 | 1.09e-67 |