Gene maize_pan_p023740
| Sequence ID | maize_pan_p023740 add to my list | ||
|---|---|---|---|
| Species | Zea mays | ||
| Alias | No gene alias | ||
| Pangenome status | Core (4/4) | ||
| Length | 90aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 90 amino acids
>maize_pan_p023740_MAIZE MESTELKVEMVALHEKRVRRCLSKVKGIERVEVEASLQKVVVTGCVNRSKILKALRRVGL RAEPWSPHNELLSAYAATTTLVFNNSYAFF
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maize_pan_p023740
Represented sequence(s):
MAIZE_Mo17_v1.0
MAIZE_PH207_v1.0
MAIZE_CML247_v1.0
MAIZE_B73_v4.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_12_32.9 | orthology | 0.75 | 9 | - | - |
| Ca_3_262.11 | orthology | 0.75 | 9 | - | - |
| Ca_455_136.3 | orthology | 0.75 | 9 | - | - |
| Ca_68_16.11 | orthology | 0.773 | 9 | 104 | 1.07e-30 |
| Cc10_g00290 | orthology | 0.773 | 9 | 92.8 | 1.47e-26 |
| Cg3g025710.1 | orthology | 0.644 | 11 | 108 | 1.53e-32 |
| Cm122260.1 | orthology | 0.656 | 10 | 109 | 6.31e-33 |
| Cs3g27690.1 | orthology | 0.644 | 11 | 108 | 1.66e-32 |
| DCAR_023025 | orthology | 0.634 | 6 | 99.4 | 4.7e-29 |
| MELO3C017056.2.1 | orthology | 0.79 | 11 | 104 | 4.21e-31 |
| Manes.05G127500.1 | orthology | 0.682 | 9 | 105 | 2.93e-31 |
| Manes.18G002200.1 | orthology | 0.695 | 9 | - | - |
| Mba08_g25790.1 | orthology | 0.381 | 3 | 123 | 1.77e-38 |
| Oeu013567.1 | orthology | 0.654 | 7 | 93.6 | 9.98e-27 |
| Sspon.06G0001840-1A | orthology | 0.255 | 1 | - | - |
| XP_010932092.1 | orthology | 0.323 | 4 | 127 | 8.07e-40 |
| XP_017697769.1 | orthology | 0.347 | 4 | 129 | 1.31e-40 |
| XP_019707878.1 | orthology | 0.36 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_11445.1 | orthology | 0.799 | 7 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1 | orthology | 0.797 | 7 | 102 | 2.25e-30 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22894.1 | orthology | 0.795 | 6 | - | - |
| capan_pan_p037558 | orthology | 0.761 | 8 | 93.2 | 1.23e-26 |
| cicar_pan_p012771 | orthology | 0.917 | 8 | 105 | 3.08e-31 |
| cocnu_pan_p024788 | orthology | 0.323 | 4 | 123 | 1.66e-38 |
| cocnu_pan_p029661 | orthology | 0.386 | 5 | - | - |
| cucsa_pan_p017207 | orthology | 0.79 | 11 | 104 | 3.96e-31 |
| maldo_pan_p020708 | orthology | 0.679 | 9 | 102 | 3.61e-30 |
| medtr_pan_p031498 | orthology | 0.849 | 8 | 106 | 7.54e-32 |
| musac_pan_p036492 | orthology | 0.369 | 3 | 124 | 4.82e-39 |
| phavu.G19833.gnm2.ann1.Phvul.002G208500.1 | orthology | 0.806 | 6 | 102 | 4.21e-30 |
| soybn_pan_p018879 | orthology | 0.849 | 6 | 101 | 1.21e-29 |
| soybn_pan_p037728 | orthology | 0.874 | 7 | - | - |
| soybn_pan_p037999 | orthology | 0.916 | 7 | - | - |
| soybn_pan_p041984 | orthology | 0.884 | 7 | - | - |
| thecc_pan_p004256 | orthology | 0.692 | 10 | 97.8 | 1.53e-28 |
| vitvi_pan_p014910 | orthology | 0.606 | 8 | 105 | 2.15e-31 |
| vitvi_pan_p031077 | orthology | 0.606 | 8 | - | - |