Gene maize_pan_p044279
| Sequence ID | maize_pan_p044279 add to my list |
|---|---|
| Species | Zea mays |
| Alias | No gene alias |
| Pangenome status | Specific (1/4) |
| Length | 78aa |
Length: 78 amino acids
>maize_pan_p044279_MAIZE MAKGQQDKAASGGNGGGDGAAAAAGEQLVIRVPVHCDGCGRKLRRSLQRLEGKSKQVNDR PRARAAIYTCANAYYVLY
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP544114 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
Unrepresented genome(s):
MAIZE_PH207_v1.0
MAIZE_B73_v4.0
MAIZE_CML247_v1.0
MAIZE_Mo17_v1.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT2G35730.1 | orthology | 0.816 | 2 | - | - |
| Cm212920.1 | orthology | 1 | 4 | - | - |
| Manes.02G038800.1 | orthology | 1 | 4 | - | - |
| brana_pan_p001635 | orthology | 0.634 | 3 | - | - |
| brana_pan_p054319 | orthology | 0.902 | 3 | - | - |
| braol_pan_p040844 | orthology | 0.634 | 3 | - | - |
| braol_pan_p052965 | orthology | 0.902 | 3 | - | - |
| brarr_pan_p008654 | orthology | 0.633 | 2 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_01523.1 | orthology | 0.837 | 5 | - | - |
| cicar_pan_p024775 | orthology | 0.779 | 4 | - | - |
| cucsa_pan_p023048 | orthology | 0.831 | 4 | - | - |
| medtr_pan_p004416 | orthology | 0.88 | 4 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.003G219900.1 | orthology | 0.853 | 5 | - | - |
| soybn_pan_p039239 | orthology | 0.722 | 4 | - | - |
| soybn_pan_p043513 | orthology | 0.722 | 4 | - | - |
| soybn_pan_p045249 | orthology | 0.751 | 4 | - | - |