Gene maldo_pan_p002182
| Sequence ID | maldo_pan_p002182 add to my list | ||
|---|---|---|---|
| Species | Malus domestica | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 320aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 320 amino acids
>maldo_pan_p002182_MALDO MGEDAKQEQAKAEPKPEEKAEAKVEEKKEEEEKKEEPKPPSPFVLFVNLHCVGCAKKIER SIMRIRGVEGVVIDMAKNEVTIKGIVEPQAVCNEILKKTKRKAKVLSPLPAAEGEPIPEV VASQVSGLVTVELEVNMHCEACAEQLKKKILKLRGVQSAVTDHSSGKVMVTGTMDGDKLV EYVYRRTKKQARIVPQPEPEPEKKEDEKPAAEEAKPEEEKKEENAGKKEEDKPAEGEGKK EEGGADGGESNNKEEKGGQENKEEGKKVGEMMSGSYVNSGMDEEQMKRMMQYYYQPLFVI ERIPPPQLFSDENPNACCIS
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP126431 | Unannotated cluster |
| 4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maldo_pan_p002182
Represented sequence(s):
MALDO_Borkh_v3.0.a1
MALDO_GDDH13_v1.1
MALDO_HFTH1
| 1. | 2. | 3. | 4. | 5. | 6. | 7. | 8. | 9. | |
|---|---|---|---|---|---|---|---|---|---|
| 1. MDP0000236441 | 0.00 | -0.00 | 318.24 | 999999 | 318.24 | -0.00 | 8.95 | 1.89 | 8.95 |
| 2. MDP0000195633 | -0.00 | 0.00 | 318.24 | 999999 | 318.24 | -0.00 | 8.95 | 1.89 | 8.95 |
| 3. MDP0000139425 | 318.24 | 318.24 | 0.00 | 41.05 | -0.00 | 318.24 | 318.24 | 1.97 | 318.24 |
| 4. MD01G1229900 | 999999 | 999999 | 41.05 | 0.00 | 127.86 | 999999 | nan | 1.46 | 999999 |
| 5. MD01G1229800 | 318.24 | 318.24 | -0.00 | 127.86 | 0.00 | 318.24 | 318.24 | 4.98 | 318.24 |
| 6. MD01G1229700 | -0.00 | -0.00 | 318.24 | 999999 | 318.24 | 0.00 | 8.92 | 1.89 | 8.92 |
| 7. MD07G1301700 | 8.95 | 8.95 | 318.24 | nan | 318.24 | 8.92 | 0.00 | 10.71 | -0.00 |
| 8. HF23334-RA | 1.89 | 1.89 | 1.97 | 1.46 | 4.98 | 1.89 | 10.71 | 0.00 | 10.71 |
| 9. HF26080-RA | 8.95 | 8.95 | 318.24 | 999999 | 318.24 | 8.92 | -0.00 | 10.71 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| FvH4_7g33060.1 | orthology | 0.19 | 1 | 336 | 6.73e-116 |