Gene maldo_pan_p003250
| Sequence ID | maldo_pan_p003250 add to my list |
|---|---|
| Species | Malus domestica |
| Alias | No gene alias |
| Pangenome status | Core (3/3) |
| Length | 296aa |
Length: 296 amino acids
>maldo_pan_p003250_MALDO MGVSNKSRLFNEDSMEEDDFEEVGSGSELEEDSEEEGDVKLDEPSKKAVYNRDGIMDKLG DISWPENSGWVHKLSVDIDQEQKVDVNDDLTRELAFYTQALEGTRKAFEKLQSMGLPFLR PEDYYAEMVKSDSHMERVKSRLLVEKKKIEEADERRKARESKKLSKEIQAQKLKERAKQK KEDIESVKKWRKQRQQSGFAGGDKGSELDLDFEDGKPFERSSKKRPFVAPGDRSGGKARQ GGKPAGKKPKKRDIKDSKFGYGGRKGSKKQNVAETTNDLRGFNKDSLTSGNRKRKR
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP075980 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Eukaryotic rRNA processing
IPR008610
|
Eukaryotic rRNA processing | Family |
Figure 1: IPR domains for maldo_pan_p003250
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg9g025540.1 | orthology | 0.458 | 4 | 261 | 1.23e-86 |
| Cg9g025620.1 | orthology | 0.481 | 6 | - | - |
| Cm168920.1 | orthology | 0.491 | 5 | - | - |
| Cm169010.1 | orthology | 0.472 | 4 | 261 | 1.46e-86 |
| Cs9g15980.1 | orthology | 0.457 | 4 | - | - |
| Cs9g16070.1 | orthology | 0.474 | 4 | 268 | 2.03e-89 |
| FvH4_7g28160.1 | orthology | 0.266 | 1 | - | - |
| MELO3C005417.2.1 | orthology | 0.42 | 4 | 290 | 3.02e-98 |
| Manes.06G137800.1 | orthology | 0.469 | 4 | 280 | 4.16e-94 |
| cucsa_pan_p004862 | orthology | 0.445 | 4 | 290 | 3.46e-98 |
| maldo_pan_p017357 | ultra-paralogy | 0.057 | 0 | - | - |
| orange1.1t05624.1 | orthology | 0.481 | 6 | - | - |
| thecc_pan_p002991 | orthology | 0.407 | 3 | 298 | 3.17e-101 |