Gene maldo_pan_p004517
Sequence ID | maldo_pan_p004517 add to my list | ||
---|---|---|---|
Species | Malus domestica | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 368aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 368 amino acids
>maldo_pan_p004517_MALDO MCINKMPPINPLPLPLSLSPSLPPPSSLPLMEKPRVTEIHVRMDCNGCVQKIKKALHGIN GIYDLYIDFPQQKLTIIGWADPEKIVKAIKKTRKIATICSHTEQQTEPAPPPPEQAPENG SPAPEAANPPPSEAPPPAEAAPPAEVAPPAEPPRESPRPENPTPEPTVPTPVSAETNPGQ QIHHQRPRDVGEAHTIYHHPPDYGYRYDYSQGYNGYWNRYHNSQGPPQEPAHIPAPMGPP PMIHAPMDPPPMSHAPGPPPMSHVPMGPPPMSHSPMVPPPMSHAPMCPTPPPPMHVTHSY NTYRPSPYITEFEYIQPPPQPSHFSRMNHYNEHFSRANHYNEEQHDVNGNGNITSMFSDE NPNACTVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP047778 | Unannotated cluster |
4 | GP077656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maldo_pan_p004517
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg9g002000.1 | orthology | 0.571 | 5 | 248 | 5.53e-80 |
Cm229420.1 | orthology | 0.574 | 5 | 256 | 9.98e-83 |
Cs9g03680.1 | orthology | 0.588 | 4 | 228 | 3.88e-72 |
FvH4_4g18950.1 | orthology | 0.26 | 1 | 265 | 3.73e-87 |
Manes.15G008800.1 | orthology | 0.6 | 4 | 243 | 1.43e-78 |
cajca.ICPL87119.gnm1.ann1.C.cajan_04327.1 | orthology | 0.873 | 4 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_31773.1 | orthology | 0.734 | 5 | 201 | 6.43e-63 |
cicar_pan_p002360 | orthology | 0.949 | 5 | 146 | 1.02e-41 |
maldo_pan_p022412 | ultra-paralogy | 0.121 | 0 | - | - |
medtr_pan_p024125 | orthology | 0.972 | 5 | 138 | 9.4e-39 |
phavu.G19833.gnm2.ann1.Phvul.003G108900.1 | orthology | 0.947 | 5 | 146 | 1.08e-41 |
soybn_pan_p005812 | orthology | 0.87 | 4 | - | - |
soybn_pan_p009634 | orthology | 0.904 | 5 | - | - |
soybn_pan_p012740 | orthology | 0.705 | 5 | 145 | 2.04e-41 |
thecc_pan_p016610 | orthology | 0.538 | 3 | 246 | 5.67e-79 |
vitvi_pan_p020280 | orthology | 0.461 | 3 | 245 | 1.37e-79 |