Gene maldo_pan_p012376
| Sequence ID | maldo_pan_p012376 add to my list | ||
|---|---|---|---|
| Species | Malus domestica | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 270aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 270 amino acids
>maldo_pan_p012376_MALDO MGEEKKEEEKKEESKDEKKEEEKKEEKKEEEPPDIVLKVDMHCEACARKVARALKGFEGV EDVTTDSKASKVVVKGKAADPIKVCERLQKKSGKKVDLISPLPKPPEEKKEDQQVKEADK EEKKEQPPAVVTVVLQVRMHCDACAQVLQKRIRKIQGVESVETDVANNQVVVKGVVDPAK LAEEVYKKTRKQVSVVKEEEKKEEEKKEEEKKEAEKEGETKEGEEDKQGEDNKVDIKRSE YWPTKYYSDYSSYPNPQIFSDENPNACSVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maldo_pan_p012376
Represented sequence(s):
MALDO_Borkh_v3.0.a1
MALDO_GDDH13_v1.1
MALDO_HFTH1
| 1. | 2. | 3. | 4. | |
|---|---|---|---|---|
| 1. MDP0000223118 | 0.00 | -0.00 | -0.00 | -0.00 |
| 2. MDP0000211286 | -0.00 | 0.00 | -0.00 | -0.00 |
| 3. MD05G1360600 | -0.00 | -0.00 | 0.00 | -0.00 |
| 4. HF12376-RA | -0.00 | -0.00 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_14_162.1 | orthology | 0.566 | 9 | - | - |
| Ca_32_762.1 | orthology | 0.63 | 9 | - | - |
| Ca_69_1.19 | orthology | 0.63 | 9 | - | - |
| Ca_78_26.1 | orthology | 0.566 | 9 | - | - |
| Ca_9_645.2 | orthology | 0.625 | 8 | - | - |
| Cc09_g00430 | orthology | 0.625 | 9 | - | - |
| Cg2g046420.1 | orthology | 0.417 | 7 | 236 | 1.48e-78 |
| Cm145580.1 | orthology | 0.633 | 6 | - | - |
| Cm298860.1 | orthology | 0.423 | 6 | - | - |
| Cs2g01750.1 | orthology | 0.417 | 7 | 250 | 1.84e-83 |
| DCAR_002239 | orthology | 0.521 | 9 | - | - |
| DCAR_030843 | orthology | 0.564 | 9 | - | - |
| FvH4_3g00420.1 | orthology | 0.215 | 1 | - | - |
| HanXRQChr16g0515801 | orthology | 0.665 | 9 | - | - |
| MELO3C008010.2.1 | orthology | 0.524 | 6 | 241 | 1.54e-79 |
| Manes.09G082500.1 | orthology | 0.571 | 6 | 226 | 8.53e-74 |
| Manes.S022000.1 | orthology | 0.344 | 6 | - | - |
| Oeu029318.1 | orthology | 0.447 | 8 | - | - |
| Oeu057024.1 | orthology | 0.485 | 8 | - | - |
| PGSC0003DMP400023518 | orthology | 0.779 | 11 | - | - |
| PGSC0003DMP400026383 | orthology | 0.543 | 10 | - | - |
| Solyc04g015030.2.1 | orthology | 0.551 | 10 | - | - |
| Solyc11g012690.1.1 | orthology | 0.828 | 11 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.44 | 7 | 255 | 8.03e-86 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.377 | 7 | - | - |
| capan_pan_p012494 | orthology | 0.68 | 9 | - | - |
| capan_pan_p018045 | orthology | 0.794 | 10 | - | - |
| cicar_pan_p024449 | orthology | 0.397 | 6 | - | - |
| cucsa_pan_p011686 | orthology | 0.512 | 6 | 238 | 4.68e-78 |
| ipotf_pan_p000797 | orthology | 0.565 | 10 | 246 | 1.22e-81 |
| itb01g10210.t2 | orthology | 0.571 | 10 | - | - |
| maldo_pan_p020510 | ultra-paralogy | 0.0888 | 0 | - | - |
| medtr_pan_p010658 | orthology | 0.382 | 6 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.391 | 7 | 263 | 1.28e-88 |
| phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.428 | 7 | - | - |
| soybn_pan_p008938 | orthology | 0.371 | 6 | - | - |
| soybn_pan_p009673 | orthology | 0.403 | 6 | - | - |
| soybn_pan_p024238 | orthology | 0.385 | 6 | - | - |
| thecc_pan_p018912 | orthology | 0.224 | 2 | - | - |
| vitvi_pan_p012828 | orthology | 0.319 | 3 | - | - |