Gene maldo_pan_p015603
Sequence ID | maldo_pan_p015603 add to my list | ||
---|---|---|---|
Species | Malus domestica | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (2/3) | ||
Length | 188aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 188 amino acids
>maldo_pan_p015603_MALDO MATLLKRTFGPFISSIAYYSYFNNQDHHHHHHHHYESIINKKSKHNMPRGRPLSLQTVEL IVRMCCTGCERVVKNAIFKLRGIDSVDVDLQMEKVTVIGYVDRNKVLKAVRRAGKRAEFW PYPNPPLYFTSSSDYFKDTTNEFKESYNYYKHGYNVGDKHGNIPVTQRGDDKISNMFNDD NVNACCLM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Heavy-metal-associated, conserved site
IPR017969
|
Heavy-metal-associated, conserved site | Conserved_site |
Figure 1: IPR domains for maldo_pan_p015603
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
FvH4_5g10380.1 | orthology | 0.239 | 1 | 223 | 7.68e-75 |
HanXRQChr14g0462111 | orthology | 0.421 | 3 | - | - |
HanXRQChr17g0534061 | orthology | 0.366 | 3 | 203 | 4.55e-67 |
MELO3C005805.2.1 | orthology | 0.353 | 4 | - | - |
cucsa_pan_p009482 | orthology | 0.357 | 4 | - | - |
maldo_pan_p024088 | ultra-paralogy | 0.122 | 0 | - | - |