Gene maldo_pan_p020043
Sequence ID | maldo_pan_p020043 add to my list | ||
---|---|---|---|
Species | Malus domestica | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (2/3) | ||
Length | 74aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 74 amino acids
>maldo_pan_p020043_MALDO MGNVVELKVGLHCEECIKKILKAIKKIEDIETYNVDPQLNKVTVTGNVTEEEVVRVLQKI GKMASTWEGKEATS
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP240412 | Unannotated cluster |
3 | GP342479 | Unannotated cluster |
4 | GP464531 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maldo_pan_p020043
Represented sequence(s):
Unrepresented genome(s):
MALDO_Borkh_v3.0.a1
MALDO_GDDH13_v1.1
MALDO_HFTH1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AUR62022965-RA | orthology | 0.482 | 3 | 117 | 2.93e-36 |
Bv2_044470_umgd.t1 | orthology | 0.421 | 3 | 119 | 1.38e-37 |
thecc_pan_p001547 | orthology | 0.365 | 2 | 120 | 5.79e-38 |
vitvi_pan_p021528 | orthology | 0.25 | 3 | 124 | 2.73e-39 |
vitvi_pan_p026180 | orthology | 0.25 | 2 | - | - |
vitvi_pan_p042470 | orthology | 0.25 | 3 | - | - |