Gene maldo_pan_p024328
Sequence ID | maldo_pan_p024328 add to my list | ||
---|---|---|---|
Species | Malus domestica | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (2/3) | ||
Length | 144aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 144 amino acids
>maldo_pan_p024328_MALDO MFGWRNGKSKHLSKAMSDIGFDMLSVTSRYVVDTNRYGVDSLEIDMDTQKVTVTGYVDQR KVLKVVRRTGRRAEFWPFPYDSEYYPYASQYFDESTYSSSYNYYMHGYNEGVHGYFPDQL YSTVADNTVHLFSDDNVHAYCTLM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maldo_pan_p024328
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G56891.1 | orthology | 0.843 | 6 | - | - |
Ca_28_123.1 | orthology | 0.662 | 7 | - | - |
Ca_31_155.3 | orthology | 0.618 | 7 | - | - |
Ca_64_676.1 | orthology | 0.579 | 7 | 109 | 2.09e-31 |
Ca_78_1273.1 | orthology | 0.618 | 7 | - | - |
Cc06_g21060 | orthology | 0.533 | 7 | - | - |
Cg6g011520.1 | orthology | 0.348 | 5 | - | - |
Cs6g10930.1 | orthology | 0.342 | 5 | - | - |
DCAR_016949 | orthology | 0.679 | 7 | - | - |
FvH4_2g26780.1 | orthology | 0.239 | 1 | - | - |
MELO3C019416.2.1 | orthology | 0.427 | 5 | - | - |
Manes.08G099200.1 | orthology | 0.341 | 3 | - | - |
Oeu053981.1 | orthology | 0.599 | 8 | - | - |
brana_pan_p032952 | orthology | 0.991 | 7 | - | - |
brana_pan_p033418 | orthology | 0.962 | 8 | - | - |
brana_pan_p049288 | orthology | 0.99 | 6 | - | - |
braol_pan_p001934 | orthology | 0.996 | 7 | - | - |
braol_pan_p038031 | orthology | 0.939 | 7 | - | - |
brarr_pan_p006813 | orthology | 0.962 | 8 | - | - |
brarr_pan_p018750 | orthology | 0.995 | 6 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 | orthology | 0.484 | 7 | - | - |
cucsa_pan_p011351 | orthology | 0.46 | 5 | - | - |
ipotf_pan_p003030 | orthology | 0.759 | 9 | - | - |
itb11g01700.t1 | orthology | 0.755 | 9 | - | - |
maldo_pan_p038662 | ultra-paralogy | 0.0945 | 0 | - | - |
medtr_pan_p030129 | orthology | 0.435 | 5 | 122 | 4.16e-37 |
phavu.G19833.gnm2.ann1.Phvul.004G052700.1 | orthology | 0.482 | 6 | - | - |
soybn_pan_p020075 | orthology | 0.501 | 7 | 122 | 8.15e-37 |
thecc_pan_p019791 | orthology | 0.301 | 4 | - | - |
vitvi_pan_p003255 | orthology | 0.39 | 5 | - | - |