Gene maldo_pan_p027447
| Sequence ID | maldo_pan_p027447 add to my list | ||
|---|---|---|---|
| Species | Malus domestica | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 254aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 254 amino acids
>maldo_pan_p027447_MALDO MASQQEPLKYQTWILRVPMHCEGCKRKVKKVLQRTDGVYTTAIDSQQNKVTVIGNVGIQT LVKKLARKAGKQAQEWPEKLTGKDNKAEKCKNKEKQKVPNQQSVEKVEVHKLTTAQNRAT NTTEIDPTKFPGETSQNKATGGGGSPAVEVRIGESEMSVSSKKNKGKGPKDDESGSAGSG APACIGSQPVDPVDLFRTRQMAYVYPLAPCHSYVPSSPYTCAPTGHQEDDWVKATELESL QVFSDENPNACFIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maldo_pan_p027447
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| DCAR_024565 | orthology | 1 | 3 | - | - |
| FvH4_4g17940.1 | orthology | 0.975 | 1 | 139 | 6.28e-40 |
| MELO3C006660.2.1 | orthology | 1 | 5 | - | - |
| Manes.03G194600.1 | orthology | 1 | 4 | - | - |
| Manes.15G012800.1 | orthology | 1 | 4 | - | - |
| cucsa_pan_p001835 | orthology | 1 | 5 | - | - |