Gene maldo_pan_p040460
Sequence ID | maldo_pan_p040460 add to my list | ||
---|---|---|---|
Species | Malus domestica | ||
Alias | No gene alias | ||
Pangenome status | Specific (1/3) | ||
Length | 107aa | ||
Gene Ontology |
![]()
|
Length: 107 amino acids
>maldo_pan_p040460_MALDO MEAFTWLKRKGIGTADQVPLREEVVCLLAELEFNMHCGHCADDVKKCCSKTKGVESVEVD QVNKVVTVEGRFRHKQLLKCLRRANKIVKVKRLVTEEIQGQYVMQNN
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maldo_pan_p040460
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
musac_pan_p044361 | orthology | 1 | 1 | - | - |