Gene maldo_pan_p042780
Sequence ID | maldo_pan_p042780 add to my list | ||
---|---|---|---|
Species | Malus domestica | ||
Alias | No gene alias | ||
Pangenome status | Specific (1/3) | ||
Length | 212aa | ||
Gene Ontology |
![]()
|
Length: 212 amino acids
>maldo_pan_p042780_MALDO MPTAEAKSQAKPEKTIEIEEVSQPPFKYNIWVLKVRIHCEGCIKEVEKILKKIDGVYRTD SDGKIGKDSKVTVTGNVEPKILIKALAKGGKHAEMWPGSEDGNHGRPGGSGSCGIERETV EAEVVQVQDNGGKKKNESGSGAGRSKGRNGLNAVKVNEGGGAPAKSGGGGKGKEVKVEAV RQGESVNMSEQPAAAQKCFGGDYDEDDSDCEV
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maldo_pan_p042780
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
MELO3C015311.2.1 | orthology | 1 | 3 | - | - |
cucsa_pan_p016664 | orthology | 1 | 3 | - | - |
maldo_pan_p020139 | ultra-paralogy | 0.208 | 0 | - | - |
maldo_pan_p023511 | ultra-paralogy | 0.251 | 0 | - | - |
maldo_pan_p049042 | ultra-paralogy | 0.129 | 0 | - | - |
maldo_pan_p050592 | ultra-paralogy | 0.243 | 0 | - | - |
vitvi_pan_p009555 | orthology | 1 | 2 | - | - |
vitvi_pan_p043411 | orthology | 1 | 2 | - | - |