Gene maldo_pan_p043115
Sequence ID | maldo_pan_p043115 add to my list |
---|---|
Species | Malus domestica |
Alias | No gene alias |
Pangenome status | Specific (1/3) |
Length | 143aa |
Length: 143 amino acids
>maldo_pan_p043115_MALDO MNTTPIALSSIINKWRDEKGSRIPVVGKFISHYLVRSGDKKKVQEFLLTDTIVRSHRLGT PPAMPAKYIIPAVLGSFAVAWTADHYFADKKIFGGSTPSTVANKEWWEETDKKFQAWPRT AGPPVVMNPISRQNFIVKSRTDS
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for maldo_pan_p043115
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Bv_004250_qxzd.t1 | orthology | 0.466 | 5 | 132 | 1.81e-41 |
Cc06_g16730 | orthology | 0.465 | 6 | 139 | 3.57e-44 |
FvH4_6g23630.1 | orthology | 0.207 | 1 | 148 | 8.64e-48 |
Oeu008921.2 | orthology | 0.632 | 6 | - | - |
Oeu017948.1 | orthology | 0.621 | 6 | - | - |
ipotf_pan_p004891 | orthology | 0.865 | 5 | - | - |
ipotf_pan_p031007 | orthology | 0.664 | 6 | - | - |
itb15g03700.t1 | orthology | 0.664 | 6 | 126 | 4.37e-39 |
thecc_pan_p013986 | orthology | 0.255 | 2 | 143 | 7.89e-46 |
vitvi_pan_p004955 | orthology | 0.373 | 3 | - | - |
vitvi_pan_p017163 | orthology | 0.366 | 3 | - | - |
vitvi_pan_p018667 | orthology | 0.367 | 3 | 140 | 1.54e-44 |
vitvi_pan_p036875 | orthology | 0.381 | 3 | - | - |