Gene maldo_pan_p053909


Sequence ID maldo_pan_p053909  add to my list
Species Malus domestica
Alias No gene alias
Pangenome status Specific (1/3)
Length 169aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 169 amino acids

>maldo_pan_p053909_MALDO
MTIVEMIVTMDCAGCENKIRSALKKMKGVDAVDVDFNMQKVTVMGWADQEKVLRAVRKTG
KRAELWPYPYNPQYHSIGLDYYQQHQPLDHHHNHHRHKHHHDRRITAYQLPITTYKSVPK
SSSYSYNYYKHGSTNQEHGYYQPPPYSTMFNEQATAVFSDENPHACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily
Heavy-metal-associated, conserved site
IPR017969 		Heavy-metal-associated, conserved site Conserved_site

IPR006121 IPR036163 IPR017969
Figure 1: IPR domains for maldo_pan_p053909



Represented sequence(s):
MALDO_GDDH13_v1.1
MD10G1280500
Unrepresented genome(s):
MALDO_Borkh_v3.0.a1
MALDO_HFTH1


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg7g011400.1 orthology 0.766 6 167 6.11e-53
Cm129650.1 orthology 0.79 6 - -
FvH4_3g07830.1 orthology 0.365 1 239 6.75e-82
Manes.17G055500.1 orthology 0.733 5 176 3.58e-57
cajca.ICPL87119.gnm1.ann1.C.cajan_31664.1 orthology 0.742 6 153 1.25e-48
cicar_pan_p021456 orthology 0.86 6 142 1.48e-44
maldo_pan_p003465 ultra-paralogy 0.112 0 - -
soybn_pan_p018217 orthology 0.704 5 166 2.16e-53
thecc_pan_p000996 orthology 0.61 2 179 1.5e-58