Gene maldo_pan_p053909
Sequence ID | maldo_pan_p053909 add to my list | ||
---|---|---|---|
Species | Malus domestica | ||
Alias | No gene alias | ||
Pangenome status | Specific (1/3) | ||
Length | 169aa | ||
Gene Ontology |
![]()
|
Length: 169 amino acids
>maldo_pan_p053909_MALDO MTIVEMIVTMDCAGCENKIRSALKKMKGVDAVDVDFNMQKVTVMGWADQEKVLRAVRKTG KRAELWPYPYNPQYHSIGLDYYQQHQPLDHHHNHHRHKHHHDRRITAYQLPITTYKSVPK SSSYSYNYYKHGSTNQEHGYYQPPPYSTMFNEQATAVFSDENPHACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Heavy-metal-associated, conserved site
IPR017969
|
Heavy-metal-associated, conserved site | Conserved_site |
Figure 1: IPR domains for maldo_pan_p053909
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg7g011400.1 | orthology | 0.766 | 6 | 167 | 6.11e-53 |
Cm129650.1 | orthology | 0.79 | 6 | - | - |
FvH4_3g07830.1 | orthology | 0.365 | 1 | 239 | 6.75e-82 |
Manes.17G055500.1 | orthology | 0.733 | 5 | 176 | 3.58e-57 |
cajca.ICPL87119.gnm1.ann1.C.cajan_31664.1 | orthology | 0.742 | 6 | 153 | 1.25e-48 |
cicar_pan_p021456 | orthology | 0.86 | 6 | 142 | 1.48e-44 |
maldo_pan_p003465 | ultra-paralogy | 0.112 | 0 | - | - |
soybn_pan_p018217 | orthology | 0.704 | 5 | 166 | 2.16e-53 |
thecc_pan_p000996 | orthology | 0.61 | 2 | 179 | 1.5e-58 |