Gene medtr_pan_p004416
Sequence ID | medtr_pan_p004416 add to my list | ||
---|---|---|---|
Species | Medicago truncatula | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 110aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 110 amino acids
>medtr_pan_p004416_MEDTR MASRNENDNRSLLYLENLTLPSFQVVVIEATTGCNGCQERVSRIVSKMIGLTEYTIDVRK NEVSVKGDFMARCDFQSKSFRSRALKSSTDQPKSLFACLTQFDKHKCNKK
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP022701 | Unannotated cluster |
3 | GP047979 | Unannotated cluster |
4 | GP468909 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for medtr_pan_p004416
Represented sequence(s):
MEDTR_A17_r5.0
MEDTR_Mt4.0v2
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT2G35730.1 | orthology | 1 | 5 | 73.9 | 1.9e-18 |
Cm212920.1 | orthology | 1 | 5 | 74.7 | 1.38e-18 |
Manes.02G038800.1 | orthology | 1 | 5 | 80.5 | 5.21e-21 |
brana_pan_p001635 | orthology | 1 | 6 | 77 | 2.14e-19 |
brana_pan_p054319 | orthology | 1 | 6 | - | - |
braol_pan_p040844 | orthology | 1 | 6 | 77 | 1.94e-19 |
braol_pan_p052965 | orthology | 1 | 6 | - | - |
brarr_pan_p008654 | orthology | 1 | 5 | 77.8 | 1.43e-19 |
cajca.ICPL87119.gnm1.ann1.C.cajan_01523.1 | orthology | 0.506 | 4 | 126 | 2.95e-39 |
cicar_pan_p024775 | orthology | 0.241 | 1 | 169 | 2.18e-56 |
cucsa_pan_p023048 | orthology | 1 | 5 | - | - |
maize_pan_p044279 | orthology | 0.88 | 4 | - | - |
phavu.G19833.gnm2.ann1.Phvul.003G219900.1 | orthology | 0.522 | 4 | 127 | 1.63e-39 |
soybn_pan_p039239 | orthology | 0.391 | 3 | 135 | 1.17e-42 |
soybn_pan_p043513 | orthology | 0.391 | 3 | - | - |
soybn_pan_p045249 | orthology | 0.421 | 3 | - | - |