Gene medtr_pan_p007037
| Sequence ID | medtr_pan_p007037 add to my list |
|---|---|
| Species | Medicago truncatula |
| Alias | No gene alias |
| Pangenome status | Core (2/2) |
| Length | 115aa |
Length: 115 amino acids
>medtr_pan_p007037_MEDTR MGICRGSFAAIPNGGFVTGQYPSSMLMNMNGFNNHPFSLMNMLARHAMQQQPQMMYYTSP FLFLLILAIIITIIITTFMQITPSNYSYKLLLCKSHFISLVGQVCVRMLDVFVCL
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP587968 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
MEDTR_A17_r5.0
MEDTR_Mt4.0v2
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Solyc06g008950.1.1 | orthology | 1 | 2 | - | - |
| capan_pan_p030823 | orthology | 1 | 2 | - | - |