Gene medtr_pan_p031372
| Sequence ID | medtr_pan_p031372 add to my list | ||
|---|---|---|---|
| Species | Medicago truncatula | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 140aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 140 amino acids
>medtr_pan_p031372_MEDTR MSNMVEVRVPNLDCEGCASKLKKALFKLKGVDDVEVEMEAQKVTVRGYGLEEKKVLKAIK RAGKAAEPWPFLPGHTHFASFYKYPSYIVNHYYNDAYKSEATNGVHTFFHTPSVYSVAVA SDEAFASMFSDDNPHACTIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for medtr_pan_p031372
Represented sequence(s):
MEDTR_Mt4.0v2
MEDTR_A17_r5.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G48970.1 | orthology | 0.304 | 3 | 226 | 8.32e-78 |
| AUR62015981-RA | orthology | 0.419 | 6 | 221 | 2.59e-74 |
| Bv3_055490_mxet.t1 | orthology | 0.452 | 6 | 218 | 7.09e-75 |
| Ca_8_1007.1 | orthology | 0.346 | 9 | 216 | 2.85e-73 |
| Cc02_g02970 | orthology | 0.346 | 9 | 215 | 1.28e-73 |
| Cg9g026790.1 | orthology | 0.172 | 5 | 235 | 2.26e-81 |
| Cm028340.1 | orthology | 0.172 | 5 | 235 | 3.79e-81 |
| Cs9g17280.1 | orthology | 0.172 | 5 | 235 | 2.45e-81 |
| DCAR_009368 | orthology | 0.425 | 11 | 219 | 7.19e-75 |
| FvH4_7g29520.1 | orthology | 0.212 | 6 | 227 | 2.72e-78 |
| HanXRQChr06g0183831 | orthology | 0.428 | 6 | - | - |
| HanXRQChr09g0253621 | orthology | 0.455 | 6 | 210 | 3.38e-71 |
| MELO3C003319.2.1 | orthology | 0.402 | 6 | 187 | 6.34e-62 |
| Manes.14G025900.1 | orthology | 0.245 | 6 | 234 | 7.49e-81 |
| Mba01_g04690.1 | orthology | 0.674 | 11 | 177 | 2.85e-58 |
| Oeu024220.1 | orthology | 0.321 | 8 | 216 | 1.05e-73 |
| PGSC0003DMP400025270 | orthology | 0.339 | 11 | 225 | 2.57e-77 |
| Solyc03g025790.2.1 | orthology | 0.329 | 11 | 224 | 7.32e-77 |
| brana_pan_p044950 | orthology | 0.277 | 4 | 232 | 7.89e-80 |
| braol_pan_p025375 | orthology | 0.277 | 5 | 234 | 9.31e-81 |
| brarr_pan_p005835 | orthology | 0.277 | 5 | 234 | 8.29e-81 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.0833 | 3 | 255 | 2.07e-89 |
| capan_pan_p012989 | orthology | 0.352 | 10 | 224 | 7.83e-77 |
| cucsa_pan_p007884 | orthology | 0.369 | 6 | 194 | 6.15e-65 |
| evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.638 | 9 | 179 | 2.19e-59 |
| ipotf_pan_p019855 | orthology | 0.351 | 10 | 212 | 4.05e-72 |
| ipotf_pan_p021461 | orthology | 0.523 | 10 | - | - |
| itb03g13280.t1 | orthology | 0.351 | 10 | 212 | 4.39e-72 |
| itb12g25750.t1 | orthology | 0.509 | 10 | - | - |
| maldo_pan_p005834 | orthology | 0.218 | 6 | 233 | 1.61e-80 |
| maldo_pan_p046866 | orthology | 0.642 | 6 | - | - |
| musac_pan_p029616 | orthology | 0.661 | 11 | 176 | 4.47e-58 |
| phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.0812 | 3 | 260 | 3.17e-91 |
| soybn_pan_p030070 | orthology | 0.0573 | 2 | 226 | 6.3e-78 |
| thecc_pan_p002573 | orthology | 0.192 | 6 | 241 | 1.24e-83 |
| vitvi_pan_p028565 | orthology | 0.264 | 5 | 215 | 1.57e-73 |