Gene medtr_pan_p036900


Sequence ID medtr_pan_p036900  add to my list
Species Medicago truncatula
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 126aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 126 amino acids

>medtr_pan_p036900_MEDTR
MTVKYFCMVMRINIDCNGCYRKVKRTLLEMPELESHFLEKKQTRVIVCGSFIPQDVAIKI
KKKTNRRVEILDIQDLSENNAENIEEQKPSTSPQKPIERNMFGLIETKREMPALNHRVQY
TTNCHF




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP109350 Unannotated cluster
3 GP119142 Unannotated cluster
4 GP077996 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR036163
Figure 1: IPR domains for medtr_pan_p036900



Represented sequence(s):
MEDTR_A17_r5.0
MtrunA17_Chr6g0484661
Unrepresented genome(s):
MEDTR_Mt4.0v2


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Bv5_110870_wcqq.t1 orthology 1 8 123 7.51e-38
Bv5_110870_wcqq.t2 orthology 1 8 - -
CgUng002450.1 orthology 1 7 122 2.05e-37
Cm118330.1 orthology 1 6 120 2.81e-36
Cs7g26570.1 orthology 1 7 122 2.23e-37
FvH4_5g12320.1 orthology 1 6 128 5.85e-39
Manes.05G138100.1 orthology 0.883 3 110 5.91e-32
PGSC0003DMP400010112 orthology 0.975 3 124 1.46e-37
Solyc03g119630.2.1 orthology 1 4 127 2.5e-39
capan_pan_p000343 orthology 1 4 - -
cicar_pan_p024669 orthology 0.107 1 194 1.29e-65
cucsa_pan_p010693 orthology 1 8 117 1.96e-35
maldo_pan_p026714 orthology 1 6 118 2.19e-35
thecc_pan_p001600 orthology 1 7 120 8.21e-36
vitvi_pan_p014384 orthology 1 6 124 4.95e-37