Gene medtr_pan_p040178
Sequence ID | medtr_pan_p040178 add to my list |
---|---|
Species | Medicago truncatula |
Alias | No gene alias |
Pangenome status | Dispensable (1/2) |
Length | 64aa |
Length: 64 amino acids
>medtr_pan_p040178_MEDTR MEFLKLFIVALMPVLKVLLITVLGTFLALDRFDILSRETARKNLNTMTPNLVACDTIGSC MCLK
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Auxin efflux carrier family
GP000355 |
Auxin efflux carrier family |
2 | GP015273 | Unannotated cluster |
3 | GP040583 | Unannotated cluster |
4 | GP463693 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.