Gene musac_pan_p009117
Sequence ID | musac_pan_p009117 add to my list | ||
---|---|---|---|
Species | Musa acuminata | ||
Alias | No gene alias | ||
Pangenome status | Core (4/4) | ||
Length | 122aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 122 amino acids
>musac_pan_p009117_MUSAC MANLQIVPAGKNVEAQYVEMKVPLYSYGCEKKVKKALSHRRGIHSVHVDYKMQKVTVWGI CNKDDVLATIRKKRREARFWEQAEPEAAEGKVEDEMAVAKASRLAAAKGHRLRLSWKKLF PL
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP342521 | Unannotated cluster |
4 | GP077751 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for musac_pan_p009117
Represented sequence(s):
MUSAC_Macma2
MUSAC_Macbu1
MUSAC_Macze1
MUSAC_Macba2
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU2Hr1G093870.1 | orthology | 0.75 | 6 | 142 | 6.22e-45 |
Mba04_g24060.1 | orthology | 0.0165 | 1 | 239 | 2.38e-83 |
Sspon.05G0023740-1B | orthology | 0.53 | 4 | - | - |
Sspon.05G0023740-1P | orthology | 0.53 | 5 | - | - |
Sspon.05G0023740-2D | orthology | 0.53 | 5 | 155 | 5.78e-50 |
XP_008808278.1 | orthology | 0.426 | 3 | 180 | 7.99e-60 |
XP_010919018.1 | orthology | 0.433 | 4 | - | - |
XP_010934032.1 | orthology | 0.391 | 3 | 176 | 2e-58 |
bradi_pan_p042306 | orthology | 0.778 | 5 | 144 | 1.27e-45 |
cocnu_pan_p020678 | orthology | 0.407 | 3 | - | - |
cocnu_pan_p024529 | orthology | 0.48 | 4 | 177 | 1.52e-58 |
maize_pan_p011588 | orthology | 0.617 | 3 | 139 | 6.96e-44 |
orysa_pan_p048607 | orthology | 0.709 | 4 | 152 | 4.69e-49 |
orysa_pan_p051674 | orthology | 1 | 4 | - | - |
sorbi_pan_p001968 | orthology | 0.546 | 4 | 155 | 4.26e-50 |
tritu_pan_p012747 | orthology | 0.751 | 6 | 144 | 1.73e-45 |
tritu_pan_p017403 | orthology | 0.76 | 6 | - | - |
tritu_pan_p047012 | orthology | 0.743 | 6 | - | - |