Gene musac_pan_p014845
| Sequence ID | musac_pan_p014845 add to my list |
|---|---|
| Species | Musa acuminata |
| Alias | No gene alias |
| Pangenome status | Dispensable (2/4) |
| Length | 56aa |
Length: 56 amino acids
>musac_pan_p014845_MUSAC MAAAEEGPEPLKYQTLALKVSTHCEGCKREVKRILKHGKGFCQHLSLSLSLSLSLS
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
Unrepresented genome(s):
MUSAC_Macma2
MUSAC_Macze1
MUSAC_Macba2
MUSAC_Macbu1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba11_g12300.1 | orthology | 0.443 | 1 | - | - |
| XP_008800848.2 | orthology | 0.982 | 2 | - | - |
| XP_008805754.1 | orthology | 0.938 | 3 | - | - |
| XP_010914416.1 | orthology | 0.963 | 4 | - | - |
| XP_010931631.1 | orthology | 0.978 | 3 | - | - |
| cocnu_pan_p006778 | orthology | 0.999 | 3 | - | - |
| cocnu_pan_p023410 | orthology | 0.903 | 4 | - | - |