Gene musac_pan_p019196
| Sequence ID | musac_pan_p019196 add to my list |
|---|---|
| Species | Musa acuminata |
| Alias | No gene alias |
| Pangenome status | Core (4/4) |
| Length | 79aa |
Length: 79 amino acids
>musac_pan_p019196_MUSAC MATGKIIGAIVASFAVSYACDTLISDGKIFGGTTPKTVSDKEWWEATDKKFQAWPRTAGP PVVMNPISRQNFIVKSSES
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for musac_pan_p019196
Represented sequence(s):
MUSAC_Macze1
MUSAC_Macbu1
MUSAC_Macma2
MUSAC_Macba2
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba07_g04570.1 | orthology | 0.109 | 1 | - | - |
| XP_008779151.1 | orthology | 0.561 | 2 | - | - |
| XP_019709224.1 | orthology | 0.653 | 3 | - | - |
| XP_026665743.1 | orthology | 0.518 | 2 | - | - |
| XP_026665744.1 | orthology | 0.518 | 3 | - | - |
| XP_026665745.1 | orthology | 0.518 | 3 | - | - |
| XP_026665746.1 | orthology | 0.518 | 3 | - | - |
| cocnu_pan_p023003 | orthology | 0.947 | 3 | - | - |
| cocnu_pan_p029006 | orthology | 0.947 | 3 | 128 | 6.15e-41 |
| musac_pan_p043143 | ultra-paralogy | 0.0825 | 0 | - | - |