Gene musac_pan_p036884
Sequence ID | musac_pan_p036884 add to my list | ||
---|---|---|---|
Species | Musa acuminata | ||
Alias | No gene alias | ||
Pangenome status | Specific (1/4) | ||
Length | 276aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 276 amino acids
>musac_pan_p036884_MUSAC MGEEKEKKGDGEKKKRGGMEEAVEVKLDMHCEGCAQKVRKAVKKLEGVEAVSVDPANNRL KAIGKVDPWKLKEFLEAKTKKKVDFISPKDPPKKPKGDEMKKKDEDAKDKNQKKSSNDKK PKPPASSTVVLKIRVHCDGCIQRIKRHIHKIKGVEEVTVDAARDVVTVKGTMDLKTLPAV LEDRLKRRVEIVPAKKDDGGRGGEKKEKGSGSGGEKKKEGRVEEGNKGETRTTVAEANKM EYYGPHGGFEGYGYFMEMVHAPQMFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP505135 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for musac_pan_p036884
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Dr03735 | orthology | 0.653 | 3 | 225 | 5.38e-73 |
Mba05_g07210.1 | orthology | 0.0667 | 1 | 397 | 2.23e-140 |
XP_008812153.1 | orthology | 0.565 | 3 | 238 | 8.8e-78 |
XP_010918668.1 | orthology | 0.621 | 3 | 239 | 6.24e-78 |
XP_010918671.1 | orthology | 0.621 | 3 | - | - |
XP_017701718.1 | orthology | 0.679 | 2 | - | - |
cocnu_pan_p006480 | orthology | 0.599 | 3 | - | - |
cocnu_pan_p020181 | orthology | 0.617 | 3 | - | - |