Gene orange1.1t02697.1


Sequence ID orange1.1t02697.1  add to my list
Species Citrus sinensis
Alias No gene alias
Length 187aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 187 amino acids

>orange1.1t02697.1_CITSI
MRVRGLMCQSTAAATAVCMPNDSASSVIVPRSRRPPADDHYRNTPIDDDHTRLIKYSRLI
DNSHHPPSSNYKRSLHFVPSTSSIKRQAQDDIHSHHDPKPKPNPKPMPLIKLPLASSDQV
FQVVVMRVSLHCQGCAGKLKKHLSKMEGVTSFSIDLETKRVTVMGHISPTGVLESISKVK
RAEFWPC





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for orange1.1t02697.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_23_68.6 orthology 0.678 7 150.6 2.6e-36
Ca_85_96.3 orthology 0.678 7 152 4.47e-47
Ca_9_475.1 orthology 0.687 8 - -
Cc02_g21770 orthology 0.679 8 150.6 8.9e-37
Cg3g006140.1 orthology 0.001 1 320.5 6.8e-88
Cm169730.1 orthology 0.005 3 - -
Cm169730.2.1 orthology 0.005 3 331.6 5e-91
HanXRQChr11g0336891 orthology 0.764 6 131.3 9.9e-31
MELO3C018661.2.1 orthology 0.854 9 137.1 9.7e-33
Manes.06G009700.1 orthology 0.622 4 159.8 1.8e-39
cajca.ICPL87119.gnm1.ann1.C.cajan_13580.1 orthology 1 8 - -
cucsa_pan_p000289 orthology 0.888 9 138 4.37e-42
thecc_pan_p016597 orthology 0.461 3 160 1.12e-50