Gene orange1.1t02697.1
Sequence ID | orange1.1t02697.1 add to my list | ||
---|---|---|---|
Species | Citrus sinensis | ||
Alias | No gene alias | ||
Length | 187aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 187 amino acids
>orange1.1t02697.1_CITSI MRVRGLMCQSTAAATAVCMPNDSASSVIVPRSRRPPADDHYRNTPIDDDHTRLIKYSRLI DNSHHPPSSNYKRSLHFVPSTSSIKRQAQDDIHSHHDPKPKPNPKPMPLIKLPLASSDQV FQVVVMRVSLHCQGCAGKLKKHLSKMEGVTSFSIDLETKRVTVMGHISPTGVLESISKVK RAEFWPC
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for orange1.1t02697.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_23_68.6 | orthology | 0.678 | 7 | 150.6 | 2.6e-36 |
Ca_85_96.3 | orthology | 0.678 | 7 | 152 | 4.47e-47 |
Ca_9_475.1 | orthology | 0.687 | 8 | - | - |
Cc02_g21770 | orthology | 0.679 | 8 | 150.6 | 8.9e-37 |
Cg3g006140.1 | orthology | 0.001 | 1 | 320.5 | 6.8e-88 |
Cm169730.1 | orthology | 0.005 | 3 | - | - |
Cm169730.2.1 | orthology | 0.005 | 3 | 331.6 | 5e-91 |
HanXRQChr11g0336891 | orthology | 0.764 | 6 | 131.3 | 9.9e-31 |
MELO3C018661.2.1 | orthology | 0.854 | 9 | 137.1 | 9.7e-33 |
Manes.06G009700.1 | orthology | 0.622 | 4 | 159.8 | 1.8e-39 |
cajca.ICPL87119.gnm1.ann1.C.cajan_13580.1 | orthology | 1 | 8 | - | - |
cucsa_pan_p000289 | orthology | 0.888 | 9 | 138 | 4.37e-42 |
thecc_pan_p016597 | orthology | 0.461 | 3 | 160 | 1.12e-50 |