Gene phavu.G19833.gnm2.ann1.Phvul.001G134700.2
| Sequence ID | phavu.G19833.gnm2.ann1.Phvul.001G134700.2 add to my list |
|---|---|
| Species | Phaseolus vulgaris |
| Alias | No gene alias |
| Length | 79aa |
Length: 79 amino acids
>phavu.G19833.gnm2.ann1.Phvul.001G134700.2_PHAVU MSGKYIVSAILGSFGIAWVCDYYVSEKKIFGGSTPGTITNKEWEEETDKKLQAWPRTAGA PVVMNPISRQNFVVKSRSE
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.001G134700.2
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT1G01170.1 | orthology | 0.827 | 7 | 119 | 1.3e-27 |
| AT4G00860.1 | orthology | 1 | 7 | - | - |
| FvH4_3g28670.1 | orthology | 0.682 | 6 | 130.6 | 4.4e-31 |
| FvH4_5g27260.1 | orthology | 0.807 | 6 | - | - |
| brana_pan_p024628 | orthology | 1 | 8 | - | - |
| brana_pan_p024714 | orthology | 0.908 | 9 | - | - |
| brana_pan_p026080 | orthology | 1 | 7 | - | - |
| brana_pan_p037961 | orthology | 1 | 9 | - | - |
| brana_pan_p051583 | orthology | 0.868 | 7 | 120 | 2.19e-37 |
| brana_pan_p052365 | orthology | 1 | 7 | - | - |
| braol_pan_p021770 | orthology | 1 | 9 | - | - |
| braol_pan_p035423 | orthology | 1 | 8 | - | - |
| braol_pan_p040163 | orthology | 0.908 | 9 | - | - |
| braol_pan_p054491 | orthology | 1 | 7 | 121 | 8.28e-38 |
| brarr_pan_p004667 | orthology | 1 | 8 | - | - |
| brarr_pan_p009605 | orthology | 1 | 8 | - | - |
| brarr_pan_p016999 | orthology | 1 | 7 | 112 | 3.35e-34 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_09476.1 | orthology | 0.136 | 2 | 152.5 | 1.2e-37 |
| cicar_pan_p021438 | orthology | 0.456 | 4 | - | - |
| cicar_pan_p021882 | orthology | 0.456 | 4 | 139 | 1.95e-45 |
| maldo_pan_p050830 | orthology | 0.665 | 6 | - | - |
| medtr_pan_p001744 | orthology | 0.377 | 3 | 134 | 5.48e-43 |
| medtr_pan_p009141 | orthology | 0.379 | 3 | - | - |
| soybn_pan_p000766 | orthology | 0.123 | 1 | - | - |
| soybn_pan_p008913 | orthology | 0.139 | 1 | - | - |
| soybn_pan_p014436 | orthology | 0.151 | 1 | 156 | 6.28e-52 |
| soybn_pan_p035092 | orthology | 0.138 | 1 | - | - |