Gene phavu.G19833.gnm2.ann1.Phvul.001G205300.1
| Sequence ID | phavu.G19833.gnm2.ann1.Phvul.001G205300.1 add to my list | ||
|---|---|---|---|
| Species | Phaseolus vulgaris | ||
| Alias | No gene alias | ||
| Length | 326aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 326 amino acids
>phavu.G19833.gnm2.ann1.Phvul.001G205300.1_PHAVU MFLTSFGHQQTHRDIHLDKLSSSLDFHSTEVPTYQMAAKPAEEGPQGETLKYQTWVLKVL IHCDGCKKRVKKILQGVDGVYKTEVDSLQHKVTVTGNVDAETLIKRLSRSGRIVELWPEK PAEKKGNKKSGKPNKGGDVNKEKEDQKNGEPGADGGSNEGSKDGAGEDSDKEEHGEECEE GGGGDEGGKKKKKKKKKKNKGENAGSASAPPKSGEGGGEISKVDALVPSNLDPSMAPKDL VSPPIQQAFPYPHMYYPPPPPAYGLSYNTTYPIPSDSYYVGSPFMPMHGYTTPYSRLPPP PPPSDPIKHYGGDEDEYEGGGYCSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.001G205300.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg5g037020.1 | orthology | 1 | 5 | 120.9 | 1.4e-27 |
| Cm177940.1 | orthology | 1 | 6 | 120.9 | 2.3e-27 |
| Cs5g32830.1 | orthology | 1 | 6 | 121.3 | 1.1e-27 |
| FvH4_2g25240.1 | orthology | 1 | 7 | 113.6 | 2.3e-25 |
| FvH4_3g05420.1 | orthology | 1 | 7 | - | - |
| Manes.01G216400.1 | orthology | 1 | 5 | 131.7 | 9.4e-31 |
| Manes.05G064600.1 | orthology | 1 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_10299.1 | orthology | 0.237 | 2 | 204.1 | 1.5e-52 |
| maldo_pan_p006711 | orthology | 1 | 7 | 135 | 9.13e-37 |
| maldo_pan_p033280 | orthology | 1 | 7 | - | - |
| soybn_pan_p005697 | orthology | 0.196 | 1 | - | - |
| soybn_pan_p010098 | orthology | 0.221 | 1 | 330 | 1.96e-112 |
| thecc_pan_p017549 | orthology | 1 | 4 | 148 | 4.37e-42 |
| vitvi_pan_p002541 | orthology | 1 | 6 | 130 | 5.03e-36 |