Gene phavu.G19833.gnm2.ann1.Phvul.002G262500.1


Sequence ID phavu.G19833.gnm2.ann1.Phvul.002G262500.1  add to my list
Species Phaseolus vulgaris
Alias No gene alias
Length 153aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 153 amino acids

>phavu.G19833.gnm2.ann1.Phvul.002G262500.1_PHAVU
MGVGGTLEYLSDLMGSGYQHKKKKKKQFQTVELKVRMDCDGCELKVKNALSSLSGVKSVE
INRKQQKVTVSGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAHPYAVAAYDKKAPPGYVR
RVEVPANTGTITRYEDPYVTMFSDDNPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.002G262500.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Oeu028401.1 orthology 0.26 2 250 1.5e-66
Oeu045782.1 orthology 0.262 2 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_32091.1 orthology 0.0634 2 285 3.1e-77
soybn_pan_p035006 orthology 0.0927 2 275 1.5e-96