Gene phavu.G19833.gnm2.ann1.Phvul.003G022400.1


Sequence ID phavu.G19833.gnm2.ann1.Phvul.003G022400.1  add to my list
Species Phaseolus vulgaris
Alias No gene alias
Length 147aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 147 amino acids

>phavu.G19833.gnm2.ann1.Phvul.003G022400.1_PHAVU
MGFLHNVREVVSACVKPKEKRVPKKTVNVRVKMDCEGCVRKVKHAVEDLKGVESFDVNQK
MQRVTVTGYVDSEEVLKAVRGTGKNADNWPFVPYNLVAFPYVKGAYDIKAPSGFVRNTPD
AAGDPKSPEMKLMRLFDDENPDACSIM





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397
Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.003G022400.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU3Hr1G049780.1 orthology 1 3 - -
HORVU5Hr1G069380.4 orthology 1 3 - -
Sspon.06G0009420-1A orthology 1 3 - -
Sspon.06G0009420-2B orthology 1 2 - -
Sspon.06G0009420-3C orthology 1 2 - -
Sspon.06G0009420-4D orthology 1 2 - -
Sspon.06G0031050-1C orthology 1 2 - -
bradi_pan_p033041 orthology 1 2 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_29968.1 orthology 0.251 2 235 3.5e-62
maize_pan_p014166 orthology 1 3 - -
maize_pan_p018098 orthology 1 2 - -
orysa_pan_p050041 orthology 1 2 - -
sorbi_pan_p010234 orthology 1 2 - -
soybn_pan_p016584 orthology 0.236 2 249 1.11e-86
tritu_pan_p004483 orthology 1 3 - -
tritu_pan_p020078 orthology 1 3 - -
tritu_pan_p022314 orthology 1 2 - -
tritu_pan_p042574 orthology 1 2 - -
tritu_pan_p051510 orthology 1 2 - -