Gene phavu.G19833.gnm2.ann1.Phvul.003G086400.1
Sequence ID | phavu.G19833.gnm2.ann1.Phvul.003G086400.1 add to my list | ||
---|---|---|---|
Species | Phaseolus vulgaris | ||
Alias | No gene alias | ||
Length | 261aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 261 amino acids
>phavu.G19833.gnm2.ann1.Phvul.003G086400.1_PHAVU MGEEKKEEGNKEEAKEEKEVEEKKDESKEEPPPEIVLKVDMHCEACARKVAKALKGFQGV EDVTADSRTSKVVVKGMAADPIKVRERLQKKSGKKVELISPLPKAPEEKKEETKEPPKEE KKDEPPSVVTVVLKIRMHCEACAQVIQKRIRKIKGVESVETDLANDQVIVKGVIDPAKLV DHVYKRTKKQASIVKEEEKKEEEKKEEEKKEEKQVEEENKEEEENKTEIKRSEYWPAKNY IDYAYDPQIFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.003G086400.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_14_162.1 | orthology | 0.516 | 7 | 197.2 | 3.4e-50 |
Ca_32_762.1 | orthology | 0.58 | 7 | - | - |
Ca_69_1.19 | orthology | 0.58 | 7 | - | - |
Ca_78_26.1 | orthology | 0.516 | 7 | - | - |
Ca_9_645.2 | orthology | 0.575 | 6 | - | - |
Cc09_g00430 | orthology | 0.575 | 7 | 153.3 | 1.9e-37 |
Cg2g046420.1 | orthology | 0.414 | 7 | 217.2 | 1.1e-56 |
Cm145580.1 | orthology | 0.631 | 6 | - | - |
Cm298860.1 | orthology | 0.42 | 6 | - | - |
Cs2g01750.1 | orthology | 0.414 | 7 | 227.6 | 9.1e-60 |
DCAR_002239 | orthology | 0.471 | 7 | 205.7 | 4e-53 |
DCAR_030843 | orthology | 0.513 | 7 | - | - |
FvH4_3g00420.1 | orthology | 0.378 | 7 | 208.4 | 5.5e-54 |
HanXRQChr16g0515801 | orthology | 0.614 | 7 | 190.7 | 1.9e-48 |
MELO3C008010.2.1 | orthology | 0.521 | 6 | 213 | 1.9e-55 |
Manes.09G082500.1 | orthology | 0.568 | 6 | 229 | 3.98e-75 |
Manes.S022000.1 | orthology | 0.341 | 6 | 205.3 | 5.3e-53 |
Oeu029318.1 | orthology | 0.396 | 6 | - | - |
Oeu057024.1 | orthology | 0.435 | 6 | 224.2 | 1.5e-58 |
PGSC0003DMP400023518 | orthology | 0.728 | 9 | - | - |
PGSC0003DMP400026383 | orthology | 0.493 | 8 | 206.5 | 2.2e-53 |
Solyc04g015030.2.1 | orthology | 0.501 | 8 | 209.5 | 2.6e-54 |
Solyc11g012690.1.1 | orthology | 0.777 | 9 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.0956 | 1 | 245.4 | 4.6e-65 |
capan_pan_p012494 | orthology | 0.63 | 7 | - | - |
capan_pan_p018045 | orthology | 0.743 | 8 | - | - |
cucsa_pan_p011686 | orthology | 0.509 | 6 | 232 | 6.48e-76 |
ipotf_pan_p000797 | orthology | 0.515 | 8 | 233 | 1.27e-76 |
itb01g10210.t2 | orthology | 0.521 | 8 | 205.3 | 5.4e-53 |
maldo_pan_p012376 | orthology | 0.391 | 7 | 267 | 8.78e-90 |
maldo_pan_p020510 | orthology | 0.4 | 7 | - | - |
soybn_pan_p008938 | orthology | 0.11 | 2 | 303 | 4.69e-104 |
thecc_pan_p018912 | orthology | 0.309 | 6 | 250 | 2.82e-83 |
vitvi_pan_p012828 | orthology | 0.369 | 5 | 261 | 7.3e-88 |