Gene phavu.G19833.gnm2.ann1.Phvul.006G017000.1
| Sequence ID | phavu.G19833.gnm2.ann1.Phvul.006G017000.1 add to my list |
|---|---|
| Species | Phaseolus vulgaris |
| Alias | No gene alias |
| Length | 121aa |
Length: 121 amino acids
>phavu.G19833.gnm2.ann1.Phvul.006G017000.1_PHAVU MTKNRFEIRESLSHCLTTTMEWLALRKSVEINRKQSRVTVNGCVDPNKVLNRVKRTGKKR AEFWPYVPQHVVTYRHASGVYDKRAPSGYVRNMQSFTPSAETEEKFMSLFSEDNVNACSI M
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| cajca.ICPL87119.gnm1.ann1.C.cajan_19048.1 | orthology | 0.329 | 2 | - | - |
| cicar_pan_p020432 | orthology | 0.427 | 4 | - | - |
| medtr_pan_p015314 | orthology | 0.436 | 4 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.004G077300.1 | ultra-paralogy | 0.0869 | 0 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.008G010200.1 | ultra-paralogy | 0.186 | 0 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.L002137.1 | ultra-paralogy | 0.0904 | 0 | - | - |
| soybn_pan_p030977 | orthology | 0.27 | 1 | - | - |