Gene phavu.G19833.gnm2.ann1.Phvul.007G117600.1
Sequence ID | phavu.G19833.gnm2.ann1.Phvul.007G117600.1 add to my list | ||
---|---|---|---|
Species | Phaseolus vulgaris | ||
Alias | No gene alias | ||
Length | 183aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 183 amino acids
>phavu.G19833.gnm2.ann1.Phvul.007G117600.1_PHAVU MASLLEKAFGFEISSFIYRLFIYHHQDHHHHNKDVHRNFNMPKKGRPLSLQTVELKVRMC CTGCERVVKNAIYKLKGIDSVEVDLEMERVTVGGYVDRNKVLKAVRRAGKRAEFWPYPNP PLYFTTADHYFKDTTHEFKESYNYYRHGYNLPDKHGTIHVSHRGDDNVSNMFNDDNVNAC SVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.007G117600.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT2G18196.1 | orthology | 0.419 | 3 | 192.6 | 2.2e-49 |
brana_pan_p040174 | orthology | 0.458 | 4 | - | - |
braol_pan_p005703 | orthology | 0.458 | 5 | 199 | 9.1e-66 |
brarr_pan_p015631 | orthology | 0.458 | 5 | 199 | 8.1e-66 |
cajca.ICPL87119.gnm1.ann1.C.cajan_07046.1 | orthology | 0.097 | 2 | 268.1 | 4.7e-72 |
soybn_pan_p021167 | orthology | 0.0764 | 2 | 288 | 1.1e-100 |
soybn_pan_p023045 | orthology | 0.0862 | 2 | - | - |