Gene phavu.G19833.gnm2.ann1.Phvul.008G010200.1


Sequence ID phavu.G19833.gnm2.ann1.Phvul.008G010200.1  add to my list
Species Phaseolus vulgaris
Alias No gene alias
Length 145aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 145 amino acids

>phavu.G19833.gnm2.ann1.Phvul.008G010200.1_PHAVU
MGALTNIISNFCTVPSRKIKTMQTVEIKVKMDCDGCERKVRNAVAKMKGVKSVEINRKQS
RVTVNGCVDPNKVLNRVKRTGKKRAEFWPYVPQHVVTYPHASGVYDKRAPSGYVRNMQSF
TPSAETEEKFMSLFSEDNVNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.008G010200.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
cajca.ICPL87119.gnm1.ann1.C.cajan_19048.1 orthology 0.144 2 262.3 2e-70
cicar_pan_p020432 orthology 0.242 4 237 4.48e-82
medtr_pan_p015314 orthology 0.251 4 231 3.82e-79
phavu.G19833.gnm2.ann1.Phvul.004G077300.1 ultra-paralogy 0.223 0 - -
phavu.G19833.gnm2.ann1.Phvul.006G017000.1 ultra-paralogy 0.186 0 - -
phavu.G19833.gnm2.ann1.Phvul.L002137.1 ultra-paralogy 0.227 0 - -
soybn_pan_p030977 orthology 0.0847 1 274 1.66e-96